Lineage for d5coxd2 (5cox D:33-73)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2583007Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 2583008Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)
  8. 2583049Domain d5coxd2: 5cox D:33-73 [44282]
    Other proteins in same PDB: d5coxa1, d5coxb1, d5coxc1, d5coxd1
    complexed with hem, nag

Details for d5coxd2

PDB Entry: 5cox (more details), 3 Å

PDB Description: uninhibited mouse cyclooxygenase-2 (prostaglandin synthase-2)
PDB Compounds: (D:) cyclooxygenase-2

SCOPe Domain Sequences for d5coxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5coxd2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d5coxd2:

Click to download the PDB-style file with coordinates for d5coxd2.
(The format of our PDB-style files is described here.)

Timeline for d5coxd2: