Lineage for d3pghd2 (3pgh D:33-73)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342100Family g.3.11.1: EGF-type module [57197] (20 proteins)
  6. 342254Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 342255Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)
  8. 342269Domain d3pghd2: 3pgh D:33-73 [44272]
    Other proteins in same PDB: d3pgha1, d3pghb1, d3pghc1, d3pghd1
    complexed with flp, hem, nag

Details for d3pghd2

PDB Entry: 3pgh (more details), 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non- selective inhibitor, flurbiprofen

SCOP Domain Sequences for d3pghd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pghd2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d3pghd2:

Click to download the PDB-style file with coordinates for d3pghd2.
(The format of our PDB-style files is described here.)

Timeline for d3pghd2: