SCOPe 2.08: Domain d3pghd2: 3pgh D:33-73

Lineage for d3pghd2 (3pgh D:33-73)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)

8. Domain d3pghd2: 3pgh D:33-73 [44272]
   Other proteins in same PDB: d3pgha1, d3pghb1, d3pghc1, d3pghd1
   complexed with flp, hem, nag

Details for d3pghd2

PDB Entry: 3pgh, 2.5 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non- selective inhibitor, flurbiprofen

PDB Compounds: (D:) cyclooxygenase-2

SCOPe Domain Sequences for d3pghd2:

Sequence; same for both SEQRES and ATOM records:

>d3pghd2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d3pghd2:

• d3pghd2 first appeared (with stable ids) in SCOP 1.55
  
• d3pghd2 appears in SCOPe 2.07