![]() | Class g: Small proteins [56992] (66 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (20 proteins) |
![]() | Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries) |
![]() | Domain d3pghb2: 3pgh B:33-73 [44270] Other proteins in same PDB: d3pgha1, d3pghb1, d3pghc1, d3pghd1 |
PDB Entry: 3pgh (more details), 3 Å
SCOP Domain Sequences for d3pghb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pghb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)} anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d3pghb2: