Lineage for d1bk8__ (1bk8 -)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202781Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 202926Family g.3.7.5: Plant defensins [57170] (5 proteins)
  6. 202930Protein Antimicrobial protein 1 (AH-AMP1) [57176] (1 species)
  7. 202931Species Horse chestnut (Aesculus hippocastanum) [TaxId:43364] [57177] (1 PDB entry)
  8. 202932Domain d1bk8__: 1bk8 - [44178]

Details for d1bk8__

PDB Entry: 1bk8 (more details)

PDB Description: determination of the three-dimensional solution structure of aesculus hippocastanum antimicrobial protein 1 (ah-amp1) by 1h nmr, 25 structures

SCOP Domain Sequences for d1bk8__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk8__ g.3.7.5 (-) Antimicrobial protein 1 (AH-AMP1) {Horse chestnut (Aesculus hippocastanum)}
lcnerpsqtwsgncgntahcdkqcqdwekashgachkrenhwkcfcyfnc

SCOP Domain Coordinates for d1bk8__:

Click to download the PDB-style file with coordinates for d1bk8__.
(The format of our PDB-style files is described here.)

Timeline for d1bk8__: