Lineage for d1bk8__ (1bk8 -)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) 
Family g.3.7.5: Plant defensins [57170] (5 proteins) 
Protein Antimicrobial protein 1 (AH-AMP1) [57176] (1 species) Species Horse chestnut (Aesculus hippocastanum) [TaxId:43364] [57177] (1 PDB entry) 
Domain d1bk8__: 1bk8 - [44178]
Details for d1bk8__
PDB Entry: 1bk8 (more details)
PDB Description: determination of the three-dimensional solution structure of aesculus hippocastanum antimicrobial protein 1 (ah-amp1) by 1h nmr, 25 structures
SCOP Domain Sequences for d1bk8__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bk8__ g.3.7.5 (-) Antimicrobial protein 1 (AH-AMP1) {Horse chestnut (Aesculus hippocastanum)}
lcnerpsqtwsgncgntahcdkqcqdwekashgachkrenhwkcfcyfnc
SCOP Domain Coordinates for d1bk8__:
Click to download the PDB-style file with coordinates for d1bk8__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bk8__:
- d1bk8__ first appeared (with stable ids) in SCOP 1.55
- d1bk8__ appears in SCOP 1.57
- d1bk8__ appears in SCOP 1.61
- d1bk8__ appears in the current release, SCOPe 2.08, called d1bk8a_
View in 3D