| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) ![]() |
| Family g.3.7.4: Insect defensins [57163] (5 proteins) |
| Protein Drosomycin [57164] (1 species) inducible antifungal protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57165] (1 PDB entry) |
| Domain d1myna_: 1myn A: [44172] |
PDB Entry: 1myn (more details)
SCOPe Domain Sequences for d1myna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1myna_ g.3.7.4 (A:) Drosomycin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dclsgrykgpcavwdnetcrrvckeegrssghcspslkcwcegc
Timeline for d1myna_: