Lineage for d1myn__ (1myn -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39779Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 39899Family g.3.7.4: Insect defensins [57163] (3 proteins)
  6. 39903Protein Drosomycin [57164] (1 species)
  7. 39904Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57165] (1 PDB entry)
  8. 39905Domain d1myn__: 1myn - [44172]

Details for d1myn__

PDB Entry: 1myn (more details)

PDB Description: solution structure of drosomycin, the first inducible antifungal protein from insects, nmr, 15 structures

SCOP Domain Sequences for d1myn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myn__ g.3.7.4 (-) Drosomycin {Fruit fly (Drosophila melanogaster)}
dclsgrykgpcavwdnetcrrvckeegrssghcspslkcwcegc

SCOP Domain Coordinates for d1myn__:

Click to download the PDB-style file with coordinates for d1myn__.
(The format of our PDB-style files is described here.)

Timeline for d1myn__: