SCOPe 2.07: Domain d1mtxa_: 1mtx A:

Lineage for d1mtxa_ (1mtx A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein Margatoxin [57125] (1 species)

7. Species Scorpion (Centruroides margaritatus) [TaxId:29018] [57126] (1 PDB entry)

8. Domain d1mtxa_: 1mtx A: [44149]

Details for d1mtxa_

PDB Entry: 1mtx

PDB Description: determination of the three-dimensional structure of margatoxin by 1h, 13c, 15n triple-resonance nuclear magnetic resonance spectroscopy

PDB Compounds: (A:) margatoxin

SCOPe Domain Sequences for d1mtxa_:

Sequence; same for both SEQRES and ATOM records:

>d1mtxa_ g.3.7.2 (A:) Margatoxin {Scorpion (Centruroides margaritatus) [TaxId: 29018]}
tiinvkctspkqclppckaqfgqsagakcmngkckcyph

Timeline for d1mtxa_:

• d1mtxa_ first appeared (with stable ids) in SCOP 1.55, called d1mtx__
  
• d1mtxa_ appears in SCOPe 2.06
  
• d1mtxa_ appears in the current release, SCOPe 2.08