| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.6: omega toxin-like [57059] (5 families) ![]() |
| Family g.3.6.2: Spider toxins [57072] (25 proteins) |
| Protein mu-Agatoxin-I [57075] (1 species) |
| Species Funnel web spider (Agelenopsis aperta) [TaxId:6908] [57076] (1 PDB entry) |
| Domain d1eita_: 1eit A: [44108] |
PDB Entry: 1eit (more details)
SCOPe Domain Sequences for d1eita_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eita_ g.3.6.2 (A:) mu-Agatoxin-I {Funnel web spider (Agelenopsis aperta) [TaxId: 6908]}
ecvpenghcrdwydeccegfycscrqppkcicrnnn
Timeline for d1eita_: