Lineage for d1eita_ (1eit A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030282Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 3030323Family g.3.6.2: Spider toxins [57072] (26 proteins)
  6. 3030386Protein mu-Agatoxin-I [57075] (1 species)
  7. 3030387Species Funnel web spider (Agelenopsis aperta) [TaxId:6908] [57076] (1 PDB entry)
  8. 3030388Domain d1eita_: 1eit A: [44108]

Details for d1eita_

PDB Entry: 1eit (more details)

PDB Description: nmr study of mu-agatoxin
PDB Compounds: (A:) mu-agatoxin-I

SCOPe Domain Sequences for d1eita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eita_ g.3.6.2 (A:) mu-Agatoxin-I {Funnel web spider (Agelenopsis aperta) [TaxId: 6908]}
ecvpenghcrdwydeccegfycscrqppkcicrnnn

SCOPe Domain Coordinates for d1eita_:

Click to download the PDB-style file with coordinates for d1eita_.
(The format of our PDB-style files is described here.)

Timeline for d1eita_: