Lineage for d5aiy.6 (5aiy L:,K:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888633Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 888634Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 888635Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 888640Protein Insulin [56996] (3 species)
  7. 888650Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries)
    Uniprot P01308
  8. 888759Domain d5aiy.6: 5aiy L:,K: [43899]
    complexed with iph

Details for d5aiy.6

PDB Entry: 5aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 'red' substate, average structure
PDB Compounds: (K:) protein (insulin), (L:) protein (insulin)

SCOP Domain Sequences for d5aiy.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g5aiy.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d5aiy.6:

Click to download the PDB-style file with coordinates for d5aiy.6.
(The format of our PDB-style files is described here.)

Timeline for d5aiy.6: