![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
![]() | Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
![]() | Family g.1.1.1: Insulin-like [56995] (4 proteins) |
![]() | Protein Insulin [56996] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries) Uniprot P01308 |
![]() | Domain d5aiy.6: 5aiy L:,K: [43899] complexed with iph |
PDB Entry: 5aiy (more details)
SCOP Domain Sequences for d5aiy.6:
Sequence; same for both SEQRES and ATOM records: (download)
>g5aiy.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens) [TaxId: 9606]} fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn
Timeline for d5aiy.6: