Lineage for d5aiy.5 (5aiy J:,I:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888633Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 888634Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 888635Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 888640Protein Insulin [56996] (3 species)
  7. 888650Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries)
    Uniprot P01308
  8. 888758Domain d5aiy.5: 5aiy J:,I: [43898]

Details for d5aiy.5

PDB Entry: 5aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 'red' substate, average structure
PDB Compounds: (I:) protein (insulin), (J:) protein (insulin)

SCOP Domain Sequences for d5aiy.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g5aiy.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d5aiy.5:

Click to download the PDB-style file with coordinates for d5aiy.5.
(The format of our PDB-style files is described here.)

Timeline for d5aiy.5: