SCOP 1.59: Domain d7ahlf_: 7ahl F:

Lineage for d7ahlf_ (7ahl F:)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.6: Leukocidin (pore-forming toxin) [56958] (1 superfamily)

4. Superfamily f.6.1: Leukocidin (pore-forming toxin) [56959] (1 family)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (3 proteins)

6. Protein Alpha-hemolysin [56961] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [56962] (1 PDB entry)

8. Domain d7ahlf_: 7ahl F: [43817]

Details for d7ahlf_

PDB Entry: 7ahl, 1.9 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

SCOP Domain Sequences for d7ahlf_:

Sequence; same for both SEQRES and ATOM records:

>d7ahlf_ f.6.1.1 (F:) Alpha-hemolysin {Staphylococcus aureus}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d7ahlf_:

• d7ahlf_ first appeared (with stable ids) in SCOP 1.55
  
• d7ahlf_ appears in SCOP 1.57
  
• d7ahlf_ appears in SCOP 1.61
  
• d7ahlf_ appears in the current release, SCOPe 2.08