SCOP 1.59: Domain d7ahle_: 7ahl E:

Lineage for d7ahle_ (7ahl E:)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.6: Leukocidin (pore-forming toxin) [56958] (1 superfamily)

4. Superfamily f.6.1: Leukocidin (pore-forming toxin) [56959] (1 family)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (3 proteins)

6. Protein Alpha-hemolysin [56961] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [56962] (1 PDB entry)

8. Domain d7ahle_: 7ahl E: [43816]

Details for d7ahle_

PDB Entry: 7ahl, 1.9 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

SCOP Domain Sequences for d7ahle_:

Sequence; same for both SEQRES and ATOM records:

>d7ahle_ f.6.1.1 (E:) Alpha-hemolysin {Staphylococcus aureus}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d7ahle_:

• d7ahle_ first appeared (with stable ids) in SCOP 1.55
  
• d7ahle_ appears in SCOP 1.57
  
• d7ahle_ appears in SCOP 1.61
  
• d7ahle_ appears in the current release, SCOPe 2.08