SCOPe 2.08: Domain d7ahld_: 7ahl D:

Lineage for d7ahld_ (7ahl D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.6: Leukocidin-like [56958] (1 superfamily)
   subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel

4. Superfamily f.6.1: Leukocidin-like [56959] (3 families)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
   heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
   automatically mapped to Pfam PF07968

6. Protein Alpha-hemolysin [56961] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [56962] (9 PDB entries)

8. Domain d7ahld_: 7ahl D: [43815]

Details for d7ahld_

PDB Entry: 7ahl, 1.89 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

PDB Compounds: (D:) alpha-hemolysin

SCOPe Domain Sequences for d7ahld_:

Sequence; same for both SEQRES and ATOM records:

>d7ahld_ f.6.1.1 (D:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d7ahld_:

• d7ahld_ first appeared (with stable ids) in SCOP 1.55
  
• d7ahld_ appears in SCOPe 2.07