Lineage for d7ahlb_ (7ahl B:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39334Fold f.6: Leukocidin (pore-forming toxin) [56958] (1 superfamily)
  4. 39335Superfamily f.6.1: Leukocidin (pore-forming toxin) [56959] (1 family) (S)
  5. 39336Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (3 proteins)
  6. 39337Protein Alpha-hemolysin [56961] (1 species)
  7. 39338Species Staphylococcus aureus [TaxId:1280] [56962] (1 PDB entry)
  8. 39340Domain d7ahlb_: 7ahl B: [43813]

Details for d7ahlb_

PDB Entry: 7ahl (more details), 1.9 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

SCOP Domain Sequences for d7ahlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ahlb_ f.6.1.1 (B:) Alpha-hemolysin {Staphylococcus aureus}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOP Domain Coordinates for d7ahlb_:

Click to download the PDB-style file with coordinates for d7ahlb_.
(The format of our PDB-style files is described here.)

Timeline for d7ahlb_: