SCOPe 2.08: Domain d1osma_: 1osm A:

Lineage for d1osma_ (1osm A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Klebsiella pneumoniae [TaxId:573] [56941] (1 PDB entry)

8. Domain d1osma_: 1osm A: [43769]
   osmoporin ompk36
   complexed with d12

Details for d1osma_

PDB Entry: 1osm, 3.2 Å

PDB Description: osmoporin (ompk36) from klebsiella pneumoniae

PDB Compounds: (A:) ompk36

SCOPe Domain Sequences for d1osma_:

Sequence; same for both SEQRES and ATOM records:

>d1osma_ f.4.3.1 (A:) Porin {Klebsiella pneumoniae [TaxId: 573]}
aeiynkdgnkldlygkidglhyfsddkdvdgdqtymrlgvkgetqindqltgygqweynv
qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgalkqngdgfgts
vtydifdgisagfayanskrtddqnqlllgegdhaetytgglkydanniylatqytqtyn
atragslgfankaqnfevaaqyqfdfglrpsvaylqskgkdlngygdqdilkyvdvgaty
yfnknmstyvdykinllddnsftrsagistddvvalglvyqf

Timeline for d1osma_:

• d1osma_ first appeared (with stable ids) in SCOP 1.55
  
• d1osma_ appears in SCOPe 2.07