SCOPe 2.01: Domain d1prna_: 1prn A:

Lineage for d1prna_ (1prn A:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)

8. Domain d1prna_: 1prn A: [43762]
   complexed with c8e

Details for d1prna_

PDB Entry: 1prn, 1.96 Å

PDB Description: refined structure of porin from rhodopseudomonas blastica and comparison with the porin from rhodobacter capsulatus

PDB Compounds: (A:) porin

SCOPe Domain Sequences for d1prna_:

Sequence; same for both SEQRES and ATOM records:

>d1prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
eislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyeassfgdaqssffaynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

Timeline for d1prna_:

• d1prna_ first appeared (with stable ids) in SCOP 1.55, called d1prn__
  
• d1prna_ appears in SCOP 1.75
  
• d1prna_ appears in SCOPe 2.02
  
• d1prna_ appears in the current release, SCOPe 2.08