PDB entry 1prn

View 1prn on RCSB PDB site
Description: refined structure of porin from rhodopseudomonas blastica and comparison with the porin from rhodobacter capsulatus
Class: integral membrane protein porin
Keywords: integral membrane protein porin
Deposited on 1994-07-13, released 1994-10-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porin
    Species: Rhodobacter blasticus [TaxId:1075]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1prna_
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prnA (A:)
    eislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
    fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyeassfgdaqssffaynsk
    ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
    yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
    vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf