Lineage for d1opf__ (1opf -)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies) 
Superfamily f.4.3: Porins [56935] (3 families) 
Family f.4.3.1: Porin [56936] (1 protein) Protein Porin [56937] (4 species) 
Species Escherichia coli, different sequences [TaxId:562] [56938] (10 PDB entries) 
Domain d1opf__: 1opf - [43757]
Details for d1opf__
PDB Entry: 1opf (more details), 3.2 Å
PDB Description: the structure of ompf porin in a tetragonal crystal form
SCOP Domain Sequences for d1opf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opf__ f.4.3.1 (-) Porin {Escherichia coli, different sequences}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
SCOP Domain Coordinates for d1opf__:
Click to download the PDB-style file with coordinates for d1opf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1opf__:
- d1opf__ appears in SCOP 1.57
- d1opf__ appears in the current release, SCOPe 2.08, called d1opfa_
View in 3D