Lineage for d2omfa_ (2omf A:)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
not a true fold, gathers together transmembrane barrels of different (n,S)
annotated by the SCOP(e) curators as 'not a true fold'
Superfamily f.4.3: Porins [56935] (5 families) 
Family f.4.3.1: Porin [56936] (2 proteins)
trimer, one subunit folds into (16,20) barrel
Protein Porin [56937] (5 species) Species Escherichia coli, different sequences [TaxId:562] [56938] (29 PDB entries) 
Domain d2omfa_: 2omf A: [43749]
complexed with c8e
Details for d2omfa_
PDB Entry: 2omf (more details), 2.4 Å
PDB Description: ompf porin
PDB Compounds: (A:) matrix porin outer membrane protein fSCOPe Domain Sequences for d2omfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omfa_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
SCOPe Domain Coordinates for d2omfa_:
Click to download the PDB-style file with coordinates for d2omfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2omfa_:
- d2omfa_ first appeared (with stable ids) in SCOP 1.55, called d2omf__
- d2omfa_ appears in SCOPe 2.07
View in 3D