Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily) oligomeric transmembrane alpha-helical protein |
Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family) |
Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein) |
Protein Gated mechanosensitive channel [56904] (1 species) Large-conductance ion channel |
Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry) |
Domain d1msla_: 1msl A: [43660] |
PDB Entry: 1msl (more details), 3.5 Å
SCOP Domain Sequences for d1msla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1msla_ f.16.1.1 (A:) Gated mechanosensitive channel {Mycobacterium tuberculosis} argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
Timeline for d1msla_:
View in 3D Domains from other chains: (mouse over for more information) d1mslb_, d1mslc_, d1msld_, d1msle_ |