![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.7: Gated mechanosensitive channel [56903] (1 protein) |
![]() | Protein Gated mechanosensitive channel [56904] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry) |
![]() | Domain d1msla_: 1msl A: [43660] |
PDB Entry: 1msl (more details), 3.5 Å
SCOP Domain Sequences for d1msla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1msla_ f.2.1.7 (A:) Gated mechanosensitive channel {Mycobacterium tuberculosis} argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
Timeline for d1msla_:
![]() Domains from other chains: (mouse over for more information) d1mslb_, d1mslc_, d1msld_, d1msle_ |