SCOP 1.67: Domain d1mslc_: 1msl C:

Lineage for d1mslc_ (1msl C:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family)

5. Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein)

6. Protein Gated mechanosensitive channel [56904] (1 species)
   Large-conductance ion channel

7. Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)

8. Domain d1mslc_: 1msl C: [43662]

Details for d1mslc_

PDB Entry: 1msl, 3.5 Å

PDB Description: structure of the mscl homologue from mycobacterium tuberculosis: a gated mechanosensitive channel.

SCOP Domain Sequences for d1mslc_:

Sequence; same for both SEQRES and ATOM records:

>d1mslc_ f.16.1.1 (C:) Gated mechanosensitive channel {Mycobacterium tuberculosis}
argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

Timeline for d1mslc_:

• d1mslc_ first appeared (with stable ids) in SCOP 1.55
  
• d1mslc_ appears in SCOP 1.65
  
• d1mslc_ appears in SCOP 1.69
  
• d1mslc_ last appears in SCOP 1.71