Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins) |
Protein Potassium channel protein [56901] (1 species) |
Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries) |
Domain d1f6gc_: 1f6g C: [43658] |
PDB Entry: 1f6g (more details)
SCOP Domain Sequences for d1f6gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6gc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans} mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe rrghfvrhsekaaeeaytrttralherfdrlermlddnrr
Timeline for d1f6gc_: