Lineage for d1f6gc_ (1f6g C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023620Protein Potassium channel protein [56901] (3 species)
  7. 3023623Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 3023653Domain d1f6gc_: 1f6g C: [43658]
    full-length fold; CA-atoms only
    has additional insertions and/or extensions that are not grouped together

Details for d1f6gc_

PDB Entry: 1f6g (more details)

PDB Description: potassium channel (kcsa) full-length fold
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1f6gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6gc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrghfvrhsekaaeeaytrttralherfdrlermlddnrr

SCOPe Domain Coordinates for d1f6gc_:

Click to download the PDB-style file with coordinates for d1f6gc_.
(The format of our PDB-style files is described here.)

Timeline for d1f6gc_: