SCOP 1.65: Domain d1f6gd_: 1f6g D:

Lineage for d1f6gd_ (1f6g D:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)

8. Domain d1f6gd_: 1f6g D: [43659]
   full-length fold; CA-atoms only
   mutant

Details for d1f6gd_

PDB Entry: 1f6g

PDB Description: potassium channel (kcsa) full-length fold

SCOP Domain Sequences for d1f6gd_:

Sequence; same for both SEQRES and ATOM records:

>d1f6gd_ f.14.1.1 (D:) Potassium channel protein {Streptomyces lividans}
mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrghfvrhsekaaeeaytrttralherfdrlermlddnrr

Timeline for d1f6gd_:

• d1f6gd_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6gd_ appears in SCOP 1.63
  
• d1f6gd_ appears in SCOP 1.67
  
• d1f6gd_ appears in the current release, SCOPe 2.08