Lineage for d1bl8d_ (1bl8 D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023620Protein Potassium channel protein [56901] (3 species)
  7. 3023623Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 3023649Domain d1bl8d_: 1bl8 D: [43655]
    residues 1-125
    complexed with k

Details for d1bl8d_

PDB Entry: 1bl8 (more details), 3.2 Å

PDB Description: potassium channel (kcsa) from streptomyces lividans
PDB Compounds: (D:) protein (potassium channel protein)

SCOPe Domain Sequences for d1bl8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl8d_ f.14.1.1 (D:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOPe Domain Coordinates for d1bl8d_:

Click to download the PDB-style file with coordinates for d1bl8d_.
(The format of our PDB-style files is described here.)

Timeline for d1bl8d_: