![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (3 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
![]() | Domain d1bl8c_: 1bl8 C: [43654] residues 1-125 complexed with k |
PDB Entry: 1bl8 (more details), 3.2 Å
SCOPe Domain Sequences for d1bl8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bl8c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
Timeline for d1bl8c_: