| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) ![]() Pfam PF00520 |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
| Protein Potassium channel protein [56901] (3 species) |
| Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
| Domain d1bl8a_: 1bl8 A: [43652] residues 1-125 complexed with k |
PDB Entry: 1bl8 (more details), 3.2 Å
SCOPe Domain Sequences for d1bl8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bl8a_ f.14.1.1 (A:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
Timeline for d1bl8a_: