Lineage for d1bl8a_ (1bl8 A:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 39116Family f.2.1.6: Potassium chanel protein [56900] (1 protein)
  6. 39117Protein Potassium chanel protein [56901] (1 species)
  7. 39118Species Streptomyces lividans [TaxId:1916] [56902] (2 PDB entries)
  8. 39119Domain d1bl8a_: 1bl8 A: [43652]

Details for d1bl8a_

PDB Entry: 1bl8 (more details), 3.2 Å

PDB Description: potassium channel (kcsa) from streptomyces lividans

SCOP Domain Sequences for d1bl8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl8a_ f.2.1.6 (A:) Potassium chanel protein {Streptomyces lividans}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d1bl8a_:

Click to download the PDB-style file with coordinates for d1bl8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bl8a_: