Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.1: Rotary ATPase ring subunits [81333] (1 family) automatically mapped to Pfam PF00137 |
Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (2 proteins) |
Protein F1F0 ATP synthase subunit C [56891] (1 species) |
Species Escherichia coli [TaxId:562] [56892] (6 PDB entries) |
Domain d1c17g_: 1c17 G: [43642] Other proteins in same PDB: d1c17m_ |
PDB Entry: 1c17 (more details)
SCOPe Domain Sequences for d1c17g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c17g_ f.17.1.1 (G:) F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 562]} menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv daipmiavglglyvmfava
Timeline for d1c17g_: