SCOPe 2.06: Domain d1c17f_: 1c17 F:

Lineage for d1c17f_ (1c17 F:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.1: Rotary ATPase ring subunits [81333] (1 family)
   automatically mapped to Pfam PF00137

5. Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (2 proteins)

6. Protein F1F0 ATP synthase subunit C [56891] (1 species)

7. Species Escherichia coli [TaxId:562] [56892] (6 PDB entries)

8. Domain d1c17f_: 1c17 F: [43641]
   Other proteins in same PDB: d1c17m_

Details for d1c17f_

PDB Entry: 1c17

PDB Description: a1c12 subcomplex of f1fo atp synthase

PDB Compounds: (F:) ATP synthase subunit c

SCOPe Domain Sequences for d1c17f_:

Sequence; same for both SEQRES and ATOM records:

>d1c17f_ f.17.1.1 (F:) F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 562]}
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava

Timeline for d1c17f_:

• d1c17f_ first appeared (with stable ids) in SCOP 1.55
  
• d1c17f_ appears in SCOPe 2.05
  
• d1c17f_ appears in SCOPe 2.07
  
• d1c17f_ appears in the current release, SCOPe 2.08