Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species) |
Species Escherichia coli [TaxId:562] [81461] (2 PDB entries) |
Domain d1fftb2: 1fft B:27-117 [43628] Other proteins in same PDB: d1ffta_, d1fftb1, d1fftc2, d1fftc3, d1fftf_, d1fftg1, d1ffth2, d1ffth3 complexed with cu, hem, heo |
PDB Entry: 1fft (more details), 3.5 Å
SCOPe Domain Sequences for d1fftb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fftb2 f.17.2.1 (B:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli [TaxId: 562]} salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn kveavvwtvpiliiiflavltwktthaleps
Timeline for d1fftb2: