Lineage for d1ehkb2 (1ehk B:3-40)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 38965Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 38966Protein Cytochrome c oxidase [56884] (3 species)
  7. Species Thermus thermophilus, ba3 type [TaxId:274] [56887] (1 PDB entry)
  8. Domain d1ehkb2: 1ehk B:3-40 [43625]
    Other proteins in same PDB: d1ehkb1

Details for d1ehkb2

PDB Entry: 1ehk (more details), 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehkb2 f.2.1.3 (B:3-40) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
dehkahkailayekgwlafslamlfvfialiaytlath

SCOP Domain Coordinates for d1ehkb2 are not available.

Timeline for d1ehkb2:

Domains from same chain:
(mouse over for more information)
d1ehkb1
Domains from other chains:
(mouse over for more information)
d1ehka1, d1ehkc1