Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
Protein Cytochrome c oxidase [56884] (3 species) |
PDB Entry: 1ehk (more details), 2.4 Å
SCOP Domain Sequences for d1ehkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehkb2 f.2.1.3 (B:3-40) Cytochrome c oxidase {Thermus thermophilus, ba3 type} dehkahkailayekgwlafslamlfvfialiaytlath
Timeline for d1ehkb2: