SCOP 1.57: Domain d1eysm1: 1eys M:

Lineage for d1eysm1 (1eys M:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Thermochromatium tepidum [TaxId:1050] [56882] (1 PDB entry)

8. Domain d1eysm1: 1eys M: [43516]
   Other proteins in same PDB: d1eysc_, d1eysh1

Details for d1eysm1

PDB Entry: 1eys, 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

SCOP Domain Sequences for d1eysm1:

Sequence; same for both SEQRES and ATOM records:

>d1eysm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Thermochromatium tepidum}
peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwliaglf
ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
gtaaegaalfwrwtmgfnatmesihrwawwcavltvitagigillsgtvvdnwylwavkh
gmapaypevvtavnpyet

Timeline for d1eysm1:

• d1eysm1 first appeared (with stable ids) in SCOP 1.55
  
• d1eysm1 appears in SCOP 1.59
  
• d1eysm1 appears in the current release, SCOPe 2.08, called d1eysm_