SCOPe 2.02: Domain d2rcrh2: 2rcr H:1-35

Lineage for d2rcrh2 (2rcr H:1-35)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81486] (39 PDB entries)
   Uniprot P11846

8. Domain d2rcrh2: 2rcr H:1-35 [43508]
   Other proteins in same PDB: d2rcrh1, d2rcrl_, d2rcrm_
   complexed with bcl, bph, fe, uq

Details for d2rcrh2

PDB Entry: 2rcr, 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (H:) photosynthetic reaction center (h subunit)

SCOPe Domain Sequences for d2rcrh2:

Sequence; same for both SEQRES and ATOM records:

>d2rcrh2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]}
mvgvtafgnfdlaslaiysfwiflagliyylqten

Timeline for d2rcrh2:

• d2rcrh2 first appeared (with stable ids) in SCOP 1.55
  
• d2rcrh2 appears in SCOPe 2.01
  
• d2rcrh2 appears in SCOPe 2.03
  
• d2rcrh2 appears in the current release, SCOPe 2.08