SCOP 1.55: Domain d2rcrh2: 2rcr H:1-35

Lineage for d2rcrh2 (2rcr H:1-35)

1. Root: SCOP 1.55

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (15 PDB entries)

8. Domain d2rcrh2: 2rcr H:1-35 [43508]
   Other proteins in same PDB: d2rcrh1

Details for d2rcrh2

PDB Entry: 2rcr, 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d2rcrh2:

Sequence; same for both SEQRES and ATOM records:

>d2rcrh2 f.2.1.2 (H:1-35) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
mvgvtafgnfdlaslaiysfwiflagliyylqten

Timeline for d2rcrh2:

• d2rcrh2 appears in SCOP 1.57
  
• d2rcrh2 appears in the current release, SCOPe 2.08