Lineage for d2rcrh2 (2rcr H:1-35)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 38873Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 38874Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 38875Species Rhodobacter sphaeroides [TaxId:1063] [56881] (15 PDB entries)
  8. 38927Domain d2rcrh2: 2rcr H:1-35 [43508]
    Other proteins in same PDB: d2rcrh1

Details for d2rcrh2

PDB Entry: 2rcr (more details), 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d2rcrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcrh2 f.2.1.2 (H:1-35) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
mvgvtafgnfdlaslaiysfwiflagliyylqten

SCOP Domain Coordinates for d2rcrh2:

Click to download the PDB-style file with coordinates for d2rcrh2.
(The format of our PDB-style files is described here.)

Timeline for d2rcrh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcrh1