![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
![]() | Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [56881] (15 PDB entries) |
![]() | Domain d1aigm1: 1aig M: [43483] Other proteins in same PDB: d1aigh1, d1aigp1 |
PDB Entry: 1aig (more details), 2.6 Å
SCOP Domain Sequences for d1aigm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aigm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides} yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
Timeline for d1aigm1: