Lineage for d1aijs_ (1aij S:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. Protein M (medium) subunit [81481] (4 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (64 PDB entries)
    Uniprot P02953
  8. Domain d1aijs_: 1aij S: [43465]
    Other proteins in same PDB: d1aijh1, d1aijh2, d1aijl_, d1aijr_, d1aijt1, d1aijt2
    complexed with bcl, bph, fe2, lda, u10

Details for d1aijs_

PDB Entry: 1aij (more details), 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state
PDB Compounds: (S:) photosynthetic reaction center (m subunit)

SCOPe Domain Sequences for d1aijs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aijs_ f.26.1.1 (S:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOPe Domain Coordinates for d1aijs_ are not available.

Timeline for d1aijs_:

Domains from other chains:
(mouse over for more information)
d1aijh1, d1aijh2, d1aijl_, d1aijm_, d1aijr_, d1aijt1, d1aijt2