SCOPe 2.08: Domain d1aijt1: 1aij T:36-256

Lineage for d1aijt1 (1aij T:36-256)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d1aijt1: 1aij T:36-256 [25467]
   Other proteins in same PDB: d1aijh2, d1aijl_, d1aijm_, d1aijr_, d1aijs_, d1aijt2
   complexed with bcl, bph, fe2, lda, u10

Details for d1aijt1

PDB Entry: 1aij, 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state

PDB Compounds: (T:) photosynthetic reaction center (h subunit)

SCOPe Domain Sequences for d1aijt1:

Sequence; same for both SEQRES and ATOM records:

>d1aijt1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

Timeline for d1aijt1:

• d1aijt1 first appeared (with stable ids) in SCOP 1.55
  
• d1aijt1 appears in SCOPe 2.07