SCOP 1.63: Domain d1prcl_: 1prc L:

Lineage for d1prcl_ (1prc L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries)

8. Domain d1prcl_: 1prc L: [43443]
   Other proteins in same PDB: d1prcc_, d1prch1, d1prch2, d1prcm_
   complexed with bcl, bpb, fe, hem, lda, mq7, ns1, so4, uq1

Details for d1prcl_

PDB Entry: 1prc, 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis

SCOP Domain Sequences for d1prcl_:

Sequence; same for both SEQRES and ATOM records:

>d1prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d1prcl_:

• d1prcl_ first appeared (with stable ids) in SCOP 1.55, called d1prcl1
  
• d1prcl_ was called d1prcl1 in SCOP 1.61
  
• d1prcl_ appears in SCOP 1.65
  
• d1prcl_ appears in the current release, SCOPe 2.08