Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries) |
Domain d1prcl_: 1prc L: [43443] Other proteins in same PDB: d1prcc_, d1prch1, d1prch2, d1prcm_ complexed with bcl, bpb, fe, hem, lda, mq7, ns1, so4, uq1 |
PDB Entry: 1prc (more details), 2.3 Å
SCOP Domain Sequences for d1prcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis} allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d1prcl_:
View in 3D Domains from other chains: (mouse over for more information) d1prcc_, d1prch1, d1prch2, d1prcm_ |