SCOPe 2.02: Domain d1f16a_: 1f16 A:

Lineage for d1f16a_ (1f16 A:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Proapoptotic molecule Bax [56862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56863] (2 PDB entries)

8. Domain d1f16a_: 1f16 A: [43400]

Details for d1f16a_

PDB Entry: 1f16

PDB Description: solution structure of a pro-apoptotic protein bax

PDB Compounds: (A:) protein (apoptosis regulator bax, membrane isoform alpha)

SCOPe Domain Sequences for d1f16a_:

Sequence; same for both SEQRES and ATOM records:

>d1f16a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
ltasltiwkkmg

Timeline for d1f16a_:

• d1f16a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f16a_ appears in SCOPe 2.01
  
• d1f16a_ appears in SCOPe 2.03
  
• d1f16a_ appears in the current release, SCOPe 2.08