Lineage for d1f16a_ (1f16 A:)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) 
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) 
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (3 proteins) 
Protein Proapoptotic molecule Bax [56862] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56863] (1 PDB entry) 
Domain d1f16a_: 1f16 A: [43400]
Details for d1f16a_
PDB Entry: 1f16 (more details)
PDB Description: solution structure of a pro-apoptotic protein bax
SCOP Domain Sequences for d1f16a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f16a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens)}
mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
ltasltiwkkmg
SCOP Domain Coordinates for d1f16a_:
Click to download the PDB-style file with coordinates for d1f16a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f16a_:
- d1f16a_ appears in SCOP 1.57
- d1f16a_ appears in the current release, SCOPe 2.08
View in 3D