Lineage for d1qq6b_ (1qq6 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2526733Family c.108.1.1: HAD-related [56785] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2526737Protein L-2-Haloacid dehalogenase, HAD [56786] (2 species)
  7. 2526743Species Xanthobacter autotrophicus [TaxId:280] [56788] (4 PDB entries)
  8. 2526749Domain d1qq6b_: 1qq6 B: [43334]
    complexed with cl

Details for d1qq6b_

PDB Entry: 1qq6 (more details), 2.1 Å

PDB Description: structure of l-2-haloacid dehalogenase from xanthobacter autotrophicus with chloroacetic acid covalently bound
PDB Compounds: (B:) protein (l-2-haloacid dehalogenase)

SCOPe Domain Sequences for d1qq6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qq6b_ c.108.1.1 (B:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}
mikavvfdaygtlfdvqsvadateraypgrgeyitqvwrqkqleyswlralmgryadfws
vtrealaytlgtlglepdesfladmaqaynrltpypdaaqclaelaplkrailsngapdm
lqalvanagltdsfdavisvdakrvfkphpdsyalveevlgvtpaevlfvssngfdvgga
knfgfsvarvarlsqealarelvsgtiapltmfkalrmreetyaeapdfvvpalgdlprl
vrgma

SCOPe Domain Coordinates for d1qq6b_:

Click to download the PDB-style file with coordinates for d1qq6b_.
(The format of our PDB-style files is described here.)

Timeline for d1qq6b_: