Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.1: HAD-related [56785] (3 proteins) the insertion subdomain is a 4-helical bundle |
Protein L-2-Haloacid dehalogenase, HAD [56786] (2 species) |
Species Xanthobacter autotrophicus [TaxId:280] [56788] (4 PDB entries) |
Domain d1aq6b_: 1aq6 B: [43332] complexed with fmt |
PDB Entry: 1aq6 (more details), 1.95 Å
SCOPe Domain Sequences for d1aq6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq6b_ c.108.1.1 (B:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} mikavvfdaygtlfdvqsvadateraypgrgeyitqvwrqkqleyswlralmgryadfwg vtrealaytlgtlglepdesfladmaqaynrltpypdaaqclaelaplkrailsngapdm lqalvanagltdsfdavisvdakrvfkphpdsyalveevlgvtpaevlfvssngfdvgga knfgfsvarvarlsqealarelvsgtiapltmfkalrmreetyaeapdfvvpalgdlprl vrgma
Timeline for d1aq6b_: