SCOPe 2.07: Domain d1zrna_: 1zrn A:

Lineage for d1zrna_ (1zrn A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.1: HAD-related [56785] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein L-2-Haloacid dehalogenase, HAD [56786] (2 species)

7. Species Pseudomonas sp., strain YL [TaxId:306] [56787] (4 PDB entries)

8. Domain d1zrna_: 1zrn A: [43323]
   complexed with acy

Details for d1zrna_

PDB Entry: 1zrn, 1.83 Å

PDB Description: intermediate structure of l-2-haloacid dehalogenase with monochloroacetate

PDB Compounds: (A:) l-2-haloacid dehalogenase

SCOPe Domain Sequences for d1zrna_:

Sequence; same for both SEQRES and ATOM records:

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}
yikgiafdlygtlfdvhsvvgrcdeafpgrgreisalwrqkqleytwlrslmnryvnfqq
atedalrftcrhlgldldartrstlcdaylrlapfsevpdslrelkrrglklailsngsp
qsidavvshaglrdgfdhllsvdpvqvykpdnrvyelaeqalgldrsailfvasnawdat
garyfgfptcwinrtgnvfeemgqtpdwevtslravvelf

Timeline for d1zrna_:

• d1zrna_ first appeared (with stable ids) in SCOP 1.55, called d1zrn__
  
• d1zrna_ appears in SCOPe 2.06
  
• d1zrna_ appears in the current release, SCOPe 2.08