SCOPe 2.04: Domain d1qgxa_: 1qgx A:

Lineage for d1qgxa_ (1qgx A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)

6. Protein 3';5'-adenosine bisphosphatase, PAP phosphatase [56669] (2 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [56670] (1 PDB entry)
   sequence identical to that of Saccharomyces cerevisiae

8. Domain d1qgxa_: 1qgx A: [42973]
   complexed with amp, bme, mg, po4, so4

Details for d1qgxa_

PDB Entry: 1qgx, 1.6 Å

PDB Description: x-ray structure of yeast hal2p

PDB Compounds: (A:) 3',5'-adenosine bisphosphatase

SCOPe Domain Sequences for d1qgxa_:

Sequence; same for both SEQRES and ATOM records:

>d1qgxa_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Yeast (Candida albicans) [TaxId: 5476]}
alerellvatqavrkaslltkriqsevishkdsttitkndnspvttgdyaaqtiiinaik
snfpddkvvgeesssglsdafvsgilneikandevynknykkddflftndqfplksledv
rqiidfgnyeggrkgrfwcldpidgtkgflrgeqfavclalivdgvvqlgcigcpnlvls
sygaqdlkghesfgyifravrglgafyspssdaeswtkihvrhlkdtkdmitlegvekgh
sshdeqtaiknklniskslhldsqakycllalgladvylrlpiklsyqekiwdhaagnvi
vheaggihtdamedvpldfgngrtlatkgviassgprelhdlvvstscdviqsr

Timeline for d1qgxa_:

• d1qgxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qgxa_ appears in SCOPe 2.03
  
• d1qgxa_ appears in SCOPe 2.05
  
• d1qgxa_ appears in the current release, SCOPe 2.08