Lineage for d1qgxa_ (1qgx A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451563Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1451564Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1451565Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1451566Protein 3';5'-adenosine bisphosphatase, PAP phosphatase [56669] (2 species)
  7. 1451572Species Yeast (Candida albicans) [TaxId:5476] [56670] (1 PDB entry)
    sequence identical to that of Saccharomyces cerevisiae
  8. 1451573Domain d1qgxa_: 1qgx A: [42973]
    complexed with amp, bme, mg, po4, so4

Details for d1qgxa_

PDB Entry: 1qgx (more details), 1.6 Å

PDB Description: x-ray structure of yeast hal2p
PDB Compounds: (A:) 3',5'-adenosine bisphosphatase

SCOPe Domain Sequences for d1qgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgxa_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Yeast (Candida albicans) [TaxId: 5476]}
alerellvatqavrkaslltkriqsevishkdsttitkndnspvttgdyaaqtiiinaik
snfpddkvvgeesssglsdafvsgilneikandevynknykkddflftndqfplksledv
rqiidfgnyeggrkgrfwcldpidgtkgflrgeqfavclalivdgvvqlgcigcpnlvls
sygaqdlkghesfgyifravrglgafyspssdaeswtkihvrhlkdtkdmitlegvekgh
sshdeqtaiknklniskslhldsqakycllalgladvylrlpiklsyqekiwdhaagnvi
vheaggihtdamedvpldfgngrtlatkgviassgprelhdlvvstscdviqsr

SCOPe Domain Coordinates for d1qgxa_:

Click to download the PDB-style file with coordinates for d1qgxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qgxa_: